PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G074600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 280aa    MW: 31676.3 Da    PI: 4.5391
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G074600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.5e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd++lv+ +   G  +W+++++  g+ R++k+c++rw +yl
  Aqcoe7G074600.1.p 14 KGPWTAEEDKKLVNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                       79******************************99************97 PP

2Myb_DNA-binding52.31.3e-1670111447
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         T+ E++l +d++++lG++ W++Ia +++ gRt++++k++w+++
  Aqcoe7G074600.1.p  70 LTEAEEQLVIDLHARLGNR-WSKIAGRLP-GRTDNEIKNHWNTH 111
                        699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-20563IPR009057Homeodomain-like
PROSITE profilePS5129412.547961IPR017930Myb domain
SuperFamilySSF466896.13E-2711108IPR009057Homeodomain-like
SMARTSM007173.1E-121363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001671.30E-81661No hitNo description
PROSITE profilePS5129427.29562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2564117IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002491.2E-1469111IPR001005SANT/Myb domain
CDDcd001675.62E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLVNFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TEAEEQLVID LHARLGNRWS KIAGRLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPLK KEPKEDHQDQ ASLPTNSQPE SDSNRSEQPE NIDGVLTSEE SSSSPPEISS  180
SEETRSSSDN NNNDEDLLMS YLWQEEVEPL VNDLWKFPAT ADDGNGIGVP SWEDNCTWFS  240
FDQQEFGFDE FGLDLFNGLN MDMIMDMEPT TSAIITNDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264189.11e-116PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-101ODO1_PETHY; Protein ODORANT1
TrEMBLA0A068UQK71e-113A0A068UQK7_COFCA; Uncharacterized protein
STRINGPOPTR_0001s07830.11e-113(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.12e-87myb domain protein 85